PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr6g009430.1
Common NameMTR_6g009430
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB
Protein Properties Length: 337aa    MW: 37673.7 Da    PI: 5.7943
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr6g009430.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.74.7e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEd +++ +v+ +G g+W++++++ g++R++k+c++r+ +yl
  Medtr6g009430.1 14 RGLWTPEEDAKILAYVANHGIGNWTAVPKKAGLNRCGKSCRLRYTNYL 61
                     788*******************************************97 PP

2Myb_DNA-binding44.34.2e-1469110346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++T+eE+el++ ++   G++ W+ Ia++++ gRt++++k++w++
  Medtr6g009430.1  69 SFTPEEEELIITLHGAIGSR-WSCIAKRLP-GRTDNDVKNYWNT 110
                      79******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-24564IPR009057Homeodomain-like
PROSITE profilePS5129423.044965IPR017930Myb domain
SuperFamilySSF466895.99E-3011108IPR009057Homeodomain-like
SMARTSM007171.5E-131363IPR001005SANT/Myb domain
PfamPF002493.1E-151461IPR001005SANT/Myb domain
CDDcd001676.92E-111761No hitNo description
Gene3DG3DSA:1.10.10.602.7E-2365116IPR009057Homeodomain-like
PROSITE profilePS5129417.89966116IPR017930Myb domain
SMARTSM007179.7E-1366114IPR001005SANT/Myb domain
PfamPF002499.1E-1369110IPR001005SANT/Myb domain
CDDcd001673.11E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048658Biological Processanther wall tapetum development
GO:0052545Biological Processcallose localization
GO:0055046Biological Processmicrogametogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MGRPPCCDKT NVKRGLWTPE EDAKILAYVA NHGIGNWTAV PKKAGLNRCG KSCRLRYTNY  60
LRPDLKHDSF TPEEEELIIT LHGAIGSRWS CIAKRLPGRT DNDVKNYWNT KLRKKLMKMG  120
IDPVTHKPVS QVISDLGNIS SLTNTNSQNN LILDHTKDEQ VQPLQHQVQY HQFTNQENFQ  180
QHVLSEVASS SSSSSSSNLT RLNSPISYSC NTSQAQINSN FDWSDFLHND EPLVWTDIQQ  240
IQQCDIQRVM SSLTLSGIMQ NEGEISNNFN SNGDDKQGGS SEGFEDVACD ASKEYQGHKK  300
CEGNSFSGNS FVDGILDKDS EIRATFPEIL DASFDY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-26141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1474990.0AC147499.5 Medicago truncatula chromosome 6 clone mth2-22h5, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003618429.10.0myb transcription factor
SwissprotQ9LSI74e-84MYB35_ARATH; Transcription factor MYB35
TrEMBLG7KK080.0G7KK08_MEDTR; Myb transcription factor
STRINGGLYMA19G02090.11e-142(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.13e-77MYB family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]